PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 339aa    MW: 37905.1 Da    PI: 8.1664
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026543genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.8e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++q G+g +W + +r+ g++R++k+c++rw++yl
      Lus10026543 14 KGPWSPEEDAKLKDYIHQNGTGgNWISLPRKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.82.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T +Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
      Lus10026543  69 GEFTDDEDRIICTLFANIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.449962IPR017930Myb domain
SuperFamilySSF466897.03E-2611109IPR009057Homeodomain-like
SMARTSM007178.9E-121364IPR001005SANT/Myb domain
PfamPF002495.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-241569IPR009057Homeodomain-like
CDDcd001671.28E-81662No hitNo description
PROSITE profilePS5129421.95563117IPR017930Myb domain
SMARTSM007171.4E-1167115IPR001005SANT/Myb domain
PfamPF002495.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2370117IPR009057Homeodomain-like
CDDcd001674.66E-870113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDYIH QNGTGGNWIS LPRKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FTDDEDRIIC TLFANIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGT  120
LLPQNSSSSS HRKLPFHPHH LASYASLLQS SSLSNSVLTS SNSSLSVDHP SPNHSTNPFE  180
SNHNNYGLTR PIIANDHQLT SSNNSCSFNS AMQQHYQVKD GVFKFGGATE ASCSSSDGSS  240
NNVLQHQANK EFDYDHNEQH QQLFKMGGYS QQGSVISTTN FTDYISSTAG LCNQMIMNSP  300
NLEDYGLEEI KQLVSTCNNN NNLLLFDENR KEERVMFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082427.11e-101PREDICTED: transcription factor RAX2
TrEMBLA0A067JYX01e-101A0A067JYX0_JATCU; MYB family protein
STRINGPOPTR_0006s12530.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.12e-69myb domain protein 68